DPCstruct | MC38635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 92 ± 22 aa |
| Standard deviation of domain lengths | 21.66 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13798 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800D6H5 | 14-92 | DAGSTVTEIQLAPVSQLPEKVRRAPPVVQEAYRFAIANPEILSKLPCYCGCGGIGHRSDLDCFIEEFKPDGSIVFGYHA |
| A0A1F8LXB8 | 1-71 | MASLDGMPAEVKAAPISVQQAYQFAIAYPEIMKQIPCYCGCGAMGHTSNYACYVSDVDANGTVSYDTHALG |
| A0A7C2KU43 | 292-398 | None |
| A0A2V6YP86 | 186-251 | None |
| A0A1G6MM98 | 16-105 | None |
| A0A535BTI5 | 10-103 | None |
| B6EWU8 | 165-274 | None |
| A0A7V1BU78 | 7-73 | None |
| A0A7C1G0U5 | 14-110 | None |
| A0A7C7UQE6 | 48-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.