DPCstruct | MC38634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 143 ± 15 aa |
| Standard deviation of domain lengths | 14.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9ZP13 | 5-141 | RSRMKEEIGRAKKALALAEEGNLVGRLEMPMAVGTVGGATRSHPTARVALKIMGVQTARELAEVMAAVGLAQNLAALRALATEGIQK… |
| A0A832UJC7 | 1-107 | GEIEMPMAVGLVGGATKVHPVAKVNVKILGVQSARELAEIMGAVGLAQNVAALRALATEGIQRGHMELHARNIAVTAGVPKDKVEKI… |
| A0A177X015 | 364-498 | None |
| A0A7S3N7U0 | 108-269 | None |
| A0A0R2BYX9 | 62-218 | None |
| A0A1Y2H912 | 477-597 | None |
| A0A7H0FQV5 | 648-802 | None |
| A0A7Y5A656 | 208-359 | None |
| K1MKE3 | 246-397 | None |
| A0A7V5ST76 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.