DPCstruct | MC38632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 104 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C1AZ76 | 2-96 | AGTKRQQAIRKALRALAPGIPLSDAEAVITLAERRHMKDLPPSTALWLALGSHVRHVHTDYERLLAEGYDRDAARFFVADETDAVLA… |
| A0A7Z9Y6E4 | 14-118 | AIRRAELDREYVAQFAQRVRELYPGCPPGREQEIAEHACRKYSGRVGRSAAAKALDEEAVYLAVQAHVRHNETNYDELLMQGMDRWL… |
| G3JEJ0 | 82-177 | None |
| A0A4Q1UX69 | 94-193 | None |
| A0A517P0C7 | 186-296 | None |
| C4JIS0 | 109-205 | None |
| A0A2H4SLE1 | 67-174 | None |
| F2S8N3 | 8-136 | None |
| A0A3D8RRY8 | 317-414 | None |
| A0A545V7X6 | 82-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.