DPCstruct | MC38626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 7.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0VWQ1 | 905-989 | YQGRIQPWVHYVPVRIDYADVYNLLAFFDGGMDEERTGNHDDLAEEIANAGAEWARSHWRDIDMQAYVFRLTLEWARLMDPAREK |
| A0A0F7SNH0 | 1-104 | MATLPPWFAYVPANVDFSDLYTILAFFRGSPSSTKGMHDRVAHRIASNGQCWVERTWRIQDMQAYAFRLLLEFERAVSPDRDTGKMD… |
| A0A101MCY1 | 30-117 | None |
| B0DGG4 | 129-217 | None |
| A0A544ZSW5 | 115-213 | None |
| A0A2X0LVC2 | 5-88 | None |
| A0A0J8U541 | 30-127 | None |
| A0A0G4NB08 | 303-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.