DPCstruct | MC38624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 231 ± 21 aa |
| Standard deviation of domain lengths | 20.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12394 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183LWG5 | 1-230 | LTKVCERQLRIHLTPSRGLHYHFTVFFDYFHLCAIELAIYGALTNITSSIISWPKFSPHNTPLQTNNQIISLAQQTWHGITCSIKQP… |
| A0A3P9QIR6 | 98-345 | KKVEESLNEMDFQLCLDLYFTDGDYTPEDPSSLQNISSRVLHLHFSLQRGIHQHINVMFDYFHLSVISVAIHASLVALHQPLISFPR… |
| A0A7J7WV72 | 1-249 | None |
| A0A5E4BR35 | 349-603 | None |
| A0A821CNR2 | 1-220 | None |
| L5MIM3 | 207-418 | None |
| A0A672QS88 | 140-350 | None |
| Q49AJ0 | 98-344 | None |
| A0A2D0SFD0 | 98-344 | None |
| A0A7J8GQN3 | 6-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.