DPCstruct | MC38622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 56 ± 5 aa |
| Standard deviation of domain lengths | 4.68 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 58.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183KFZ8 | 17-74 | MPLLSTRATIYLGTWNVRTMWDTGRAFQIASEMRQYNLEVLGVSETHWTQVGQQRLAS |
| A0A183LKJ6 | 1-47 | MPLLTTGATIYLGTWNVRTIWDTGRAFQIAAEMRRYNLEVLGISETH |
| A0A183MQ13 | 1-58 | None |
| A0A183FNQ7 | 18-83 | None |
| A0A183KR39 | 1-58 | None |
| A0A183R435 | 1-60 | None |
| A0A816BUU9 | 44-101 | None |
| A0A183N7B2 | 17-71 | None |
| A0A183MDZ2 | 1-59 | None |
| A0A183LZH6 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.