DPCstruct | MC38620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 56 ± 3 aa |
| Standard deviation of domain lengths | 2.87 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.85 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0608- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0L3Y2 | 1-55 | MLAHKAEEDGFACVEFIAGKTGHVDYDKVPGVVYTHPEVASVGKTEEQVKALGVE |
| A0A2G2VJ26 | 1-55 | MLANKAEEDGDACVEFIAGKESHVDYAMVHGVVYTHREVTYVRKTEEQVEALRIY |
| R6GYW1 | 52-105 | None |
| A0A1U8EPE1 | 34-89 | None |
| A0A4V5P757 | 177-230 | None |
| A0A352QPR2 | 158-214 | None |
| A0A6I9MSI8 | 74-126 | None |
| A0A1V6KEF9 | 1-60 | None |
| A0A183JVM3 | 1-56 | None |
| A0A821LJ35 | 109-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.