DPCstruct | MC38610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 168 |
|---|---|
| Mean domain length (aa) | 288 ± 76 aa |
| Standard deviation of domain lengths | 76.41 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 74.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.96 |
| Pfam Score | 98.63 |
| Assigned Pfam label(s) | CL0364- CL0130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4L346 | 127-379 | ILGFTAFIFLIIKLNKKWIIQAIILISVAWTMYYVFIPFLSFGPYFLQKIILAEGLEIVLGPLYFLILLISIGLTFALYKFPEWYVI… |
| A0A2N3VNQ1 | 2-283 | SRLAQALTLLTALAVLIALAALYLRHVRMPRPPVGRFVRSDIAVMTVTLVSMPPIYLHLPRALTACAFGAVFLGACSMGLAPVVGGR… |
| W2IGR2 | 1-341 | None |
| A0A0F7SYW4 | 41-357 | None |
| A0A1A9VX55 | 108-329 | None |
| A0A0V0QE30 | 67-375 | None |
| A0A1D2NJ38 | 151-469 | None |
| A0A7R9UCX0 | 24-245 | None |
| K8ERM7 | 437-774 | None |
| B0EI00 | 2-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.