DPCstruct | MC3861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A0AA91 | 2-89 | LTVYLLSRRCNEPIAGQVDLLNELSLTEEGSDHAYYSRKVFSTSGRNRCFDQVEVELWFDQNKNVVEHQVQGGRWLDQAEYEQELARF |
| A0A7V0N2C4 | 19-101 | READFITFKVKCGKCGEEITVRVNRRTDLQNLYLEPGEQGAAFNLKKEILGKKCPNLIRIDVDFDRNYQVIAKEISGGAFIEP |
| A0A7C3FH95 | 13-104 | None |
| A0A1G9NV41 | 16-98 | None |
| A0A2M8QC96 | 42-136 | None |
| A0A7C6ZWW4 | 11-103 | None |
| A0A540VI05 | 9-110 | None |
| A0A7C6LDD1 | 40-123 | None |
| A0A1V5RT47 | 20-120 | None |
| A0A1F3CDX9 | 3-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.