DPCstruct | MC38607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 3 aa |
| Standard deviation of domain lengths | 2.75 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842L145 | 45-126 | VDGIILLGLHHVPGLQEDYVDGIASIVQGRSKPLVACDIGETEMALYIRGKFEKFGIPAYASPEEAAYTMSALCNYGEYLSQ |
| A0A5E4KUT0 | 1-82 | MDGLIVIYVHTLMSNAIPPAEAVVEIKRKCPKPVITCWMGGKGTEEGIDILKSGCLPNYSVPERAVKALAALIRHKEFLETV |
| A0A1V4VRA7 | 45-127 | None |
| D8F6N2 | 35-116 | None |
| A0A6A9T4H2 | 44-121 | None |
| A0A3D2NYU5 | 1-85 | None |
| A0A256KIF1 | 33-109 | None |
| A0A451APT9 | 2-78 | None |
| A0A7S0ZCF1 | 29-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.