DPCstruct | MC3860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 156 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2FPG7 | 68-235 | PKKGSFMHWFLTDRRIHLWITMGTLTLLALITLTQTFLKTSPYAHLLPPISTLPFHPIQYAREALSVIRLHIEYTTQQTNESRQQKI… |
| B2B0B8 | 2-150 | TPPPEGTWAHWFFSQKWVHITVTLGTLTALSIWTFTLNYKHNTPFGDMLPPMSDFFWHPISSTRALVEVIRLNEAHNTARIQEKRRK… |
| A0A2U3DYJ0 | 242-445 | None |
| A0A176ZZE8 | 1-148 | None |
| C8V1K0 | 103-260 | None |
| T5A2A0 | 62-212 | None |
| G9NWW4 | 25-178 | None |
| A0A165A6V5 | 124-278 | None |
| A0A2T3A3K2 | 100-233 | None |
| A0A0G2JAE3 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.