DPCstruct | MC386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 7.79 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3HGG5 | 4-94 | DLNEDQLQLEELMSRISEAGYSAGWMMGLEYELWQILNDGKGSFGRHHVTQEELQQLQFLSEKCGCWVVFDDNTEETAVDLETWKKM… |
| A3IZ42 | 11-107 | SVNSEASQLLLNMFHELSEDIYCAGWSANIEFYLWEITLETDKNTSTFLRENLKDYQIKELSRLSNLCQGWWVWKDPQGETFVSLDE… |
| A0A367Q7L1 | 42-126 | None |
| A0A537MYB9 | 99-193 | None |
| A0A1C4ITT4 | 4-106 | None |
| A0A6G8CI44 | 62-169 | None |
| A0A2T1BZD1 | 9-97 | None |
| A0A5P8WCA9 | 110-211 | None |
| A0A1Q8YF43 | 15-105 | None |
| A0A522P8S1 | 135-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.