DPCstruct | MC38598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 180 ± 17 aa |
| Standard deviation of domain lengths | 17.20 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A853N0Y5 | 3-200 | LLPYSLESQALSATTSNYIHGTAPYLTFDGGATHADSVSPLLSVTLPGNKIVTVSNDSSSLENPLVLDKLSATFADIKTLVPHRDYP… |
| A0A853N3F7 | 5-200 | KNLITLKSILFLCFCIGISHPLFVFGVLPKVKSAKTAKEIEGSAPYLTFDGGKTQSWDTDRFLNIELPDGKVLTPKNNPSTKANPIP… |
| A0A6L2ZS63 | 1-171 | None |
| A0A1B9MI72 | 7-160 | None |
| A0A1B9LNZ5 | 16-227 | None |
| A0A249DZ69 | 9-178 | None |
| A0A0U1HWW3 | 1-167 | None |
| Q8ZN56 | 13-206 | None |
| Q8ZN55 | 1-210 | None |
| A0A1B9MV93 | 2-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.