DPCstruct | MC38597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 133 ± 14 aa |
| Standard deviation of domain lengths | 13.58 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P9H0I2 | 1-164 | MNLAGMDVELTGFEPAVMETLKKLEEADFCARLWEKDPALWKMDQVEQKIIANAMGWLDSPLKIRKVVPDLNEFAAELKKAGFRHVF… |
| A0A1F8PTI6 | 366-497 | GPLTSKVVDEITRLESNKVPKRIWEHDPSLWSKDDTAAREIRNRLGWLELPTKSRDMIHEITKFAREMHEAEFRKFLLFGMGGSSLA… |
| A0A534W212 | 372-491 | None |
| A0A538C9K4 | 396-522 | None |
| A0A1J4SU31 | 365-489 | None |
| A0A2V6ZAA0 | 2-136 | None |
| A0A7V3XKW5 | 161-286 | None |
| A0A7C2ZDL3 | 92-240 | None |
| A0A2V8FNY1 | 24-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.