DPCstruct | MC3859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 210 ± 43 aa |
| Standard deviation of domain lengths | 42.91 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10445 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A431HQ34 | 5-163 | YQHYRREQVIGGAVVNFAINAALAWLLFRQMPQVPFIGSNSIVGDTLATALLLPPLLCLAVMPTFRSMFARRVVLHPARLPAAGGLP… |
| B2ARG4 | 49-314 | TITLSPPALPLPPTNKLTTPQFIYLFLLDGLGALILSGGINFAIAYAMYTAPQYTTSPGTNPDGTPQPPDKITLWSFPSTLAGDAAV… |
| R8BK88 | 159-324 | None |
| A0A0F7SUP9 | 605-857 | None |
| A0A352N616 | 34-217 | None |
| A0A2K0VXJ0 | 2-201 | None |
| A0A1P8WRU9 | 2-165 | None |
| U7Q014 | 122-417 | None |
| A0A2P6MPC2 | 24-253 | None |
| S9VPX1 | 59-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.