DPCstruct | MC38588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 316 |
|---|---|
| Mean domain length (aa) | 137 ± 26 aa |
| Standard deviation of domain lengths | 25.56 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05656 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G6NF25 | 4-130 | YISVLKQYAVFSGRARRTEYWMFVLCNVIVMQLLGMVDKLIGGDKEFISGIYSLAVLLPSLAVAVRRLHDTDRSGWWLLLVLVPIIG… |
| A0A496AM85 | 5-107 | AILFSFKGRVNRAKFWMVNLLLIVVVGIMVLIYGEEGSVILFPFGILCFWAGLAITAKRWHDRNKSAWWILIELIPILGPIWAFVEL… |
| A0A0L0LH55 | 16-135 | None |
| A0A847PKW0 | 2-148 | None |
| A0A139P2T0 | 3-173 | None |
| A0A411YHP3 | 112-261 | None |
| A0A2E1WL50 | 15-130 | None |
| A0A7W5JYZ1 | 8-161 | None |
| A0A2A3Z982 | 26-165 | None |
| A0A133LMU3 | 10-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.