DPCstruct | MC38585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 261 ± 28 aa |
| Standard deviation of domain lengths | 28.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5ZNQ2 | 309-552 | TATATPTPSAAPTVGRDERVCRKEVRKNLLRFFKAKLTALQRCINAVNRGEATPPCPDAKASAEVSEAMSRVNPARLARKCPTAVLG… |
| A0A7C2SRU7 | 208-449 | TAPCPAAPALQTRPQQRCIAALNQAAAALAVAQAKELAFCVSGFTRGKVTAGVSGCASSDARVARAAAKLADADARKCDPAELPDFA… |
| A0A534TSG7 | 6-255 | None |
| A0A534WFU1 | 14-290 | None |
| A0A534U3R8 | 10-282 | None |
| A0A534U4M8 | 4-316 | None |
| A0A3B8YSD9 | 24-327 | None |
| A0A3B8YUJ8 | 13-260 | None |
| A0A2V6U174 | 15-250 | None |
| A0A534ZA33 | 1-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.