DPCstruct | MC3858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 144 ± 13 aa |
| Standard deviation of domain lengths | 13.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6CPL3 | 96-231 | DRQASANTEGGYAKQGFYASGFEDKPGKRIPKAGYSAAAGVGRARAEYSVFEAEAKGPNASAGAEASVVGVGAMARAEIASASAKAG… |
| B2APQ3 | 26-168 | ARVQVNQDHDGVTTFYFNAGAGTDTNGCIFQTHSASTTASILHMAQTNGAEIQQANVDVLSAKANVKVETVAGVLVYYGADAGVYLA… |
| Q5XG05 | 70-207 | None |
| A0A1B9H7U3 | 155-313 | None |
| A0A397SAN7 | 5-151 | None |
| A0A803JGG7 | 224-354 | None |
| A0A2B4SQQ0 | 9-168 | None |
| A0A498LQW7 | 399-538 | None |
| A0A166FRH4 | 118-273 | None |
| A0A146G2E0 | 20-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.