DPCstruct | MC38577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09856 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8BD94 | 29-114 | ARTTSGGPSRYLGPHKSFAIGLGCDVDHADKLIYSVGIDLRDTESIVPIGAGCKICDRPACPQRAFPYLGRPVSVDPHRSTDLPYP |
| A0A2U0TI01 | 9-82 | HAMRLPLDARFSYAQDFVYADGLDLTNKAAYDPIGISCRICERVNCSQRAVSPLKSKLSIDPDIRDILPYRIVH |
| A0A7K3S641 | 1-47 | None |
| A0A1C4TQP6 | 120-184 | None |
| A0A1E5Q8M0 | 446-531 | None |
| A0A7K2JFV1 | 167-232 | None |
| A0A7R8NG63 | 61-146 | None |
| A0A7C3G0I5 | 3-68 | None |
| A0A1G4T5J4 | 244-338 | None |
| A0A011SS88 | 13-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.