DPCstruct | MC38570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 551 ± 142 aa |
| Standard deviation of domain lengths | 142.04 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453E6Z2 | 288-733 | VLGSWEYSLPSLTLYGTIESNGGSLTDAVTNSSIGPGGGSGGTVLLFVRTLSLAESSVLSSVGGFGRAGSGGGGGGRIHFHWSNIPT… |
| A0A0P0W7M6 | 8-504 | LLIYGSLSSDGESHRGTKKNSNGTYKGGIGGGSGGTILLFLQGLLLERNSSLSASGGNGGLIGGGGGGGGRIHFHWSNIATGDEYVQ… |
| A0A0V0QNE3 | 494-848 | None |
| A0A438DYT5 | 3-389 | None |
| A0A834TBJ2 | 114-721 | None |
| A0A7J6U0J1 | 113-788 | None |
| A0A6A3CDW8 | 105-715 | None |
| A0A812J8X2 | 28-988 | None |
| A0A453A9X6 | 391-795 | None |
| A0A453AA17 | 3-551 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.