DPCstruct | MC3857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 143 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2YBV4 | 168-313 | FKQSYDHINFDQVLRYVSFRRIELQKPPVSAVKARLTRNRTQTSNKGRGRDDLTVFFNWLKGKGVKHILKVMVDDLKDPSHSDKALE… |
| B2AEW0 | 12-171 | RDFVHSLTMHQEHQELLSYEETIKYARFPALDTYPDSSNTILLPIREEHSEVFDILDWLYRTKHVRTILDLKVLDRLINPHSERDIA… |
| A0A7D5UQQ9 | 416-558 | None |
| A0A2N1M095 | 350-486 | None |
| X0HP90 | 16-163 | None |
| A0A2C6AG85 | 15-164 | None |
| A0A0F4YXU3 | 146-318 | None |
| G9P1M5 | 316-450 | None |
| A0A194V779 | 364-483 | None |
| A0A4Y8CVN3 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.