DPCstruct | MC38569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Standard deviation of domain lengths | 9.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 49.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9Q4H1 | 90-170 | LDCVPLWGLASICGRRPEMEDTAIVLPRFFDVPLWIVDGLDRASFRLPAHFFGVYDGHGGVQVANYCRDRIHSVLVEELGR |
| A0A287GFN4 | 1-102 | AGGKRSVYLMECEPVWGCVATPGRGGEMEDACAAVPRFADVPVRLLARRQDLDGLGLDADALRLPSHLFAVFDGHGGSEVCICRGWK… |
| A0A0P0WR26 | 112-200 | None |
| A0A6D2KF84 | 725-809 | None |
| A0A1P8BEK2 | 109-195 | None |
| A0A2G3B7W4 | 872-957 | None |
| A0A444EI08 | 293-366 | None |
| A0A5D2QAR7 | 180-267 | None |
| A0A833QSB3 | 123-238 | None |
| A0A4D9B758 | 203-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.