DPCstruct | MC38568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 226 ± 35 aa |
| Standard deviation of domain lengths | 35.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.85 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04889 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446UIE6 | 4-189 | PLICRKEGQQTQEEVQKRNLRDELEERERKHFSSKDKSYVDERDQRKSSSLLLEGSKRDEDKIVPREIDADDSDVELKSDDESDDDD… |
| A0A369HB55 | 1-166 | MTTAHRPTFDPARGKEALRGPAYHQRLLPAHKQLKFRQAGQGGDADDDGSQRDLAAELLAAEAEAATRRNGGGKPLSGFVEAAHQGT… |
| A0A7S0V5G0 | 1-137 | None |
| A0A310SD13 | 1-237 | None |
| A0A395I569 | 1-242 | None |
| A0A0E9NBH7 | 30-272 | None |
| A0A1X1BM15 | 1-198 | None |
| A0A1G4B2T4 | 1-219 | None |
| A0A3R6Z2Q8 | 2-214 | None |
| A0A7E4VR37 | 1-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.