DPCstruct | MC38567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 62 ± 2 aa |
| Standard deviation of domain lengths | 1.64 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 90.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 64.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0B1S0 | 330-392 | REGDLVLCFKESNDEALHFDAHVLEIQRKQHDIRGCRCVFLVEYDHDGTQERVNLRRLSRRPK |
| B0LX55 | 172-232 | LPGDLILCFQEGKEQALYFDARVLDAQRRRHDVRGCRCRFLVRYDHDHSEEIVPLRKVCRR |
| A0A1U7V9C7 | 230-290 | None |
| A0A164ZSK4 | 468-528 | None |
| A0A453Q859 | 50-111 | None |
| I1K9G1 | 168-230 | None |
| A0A7J7NP17 | 43-103 | None |
| M1BLD2 | 36-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.