DPCstruct | MC38565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 6.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 53.53 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF02790- CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5YRP4 | 22-97 | FEEEFEEYQLKEEFVWFPQLFTHNTTIEVIWTIIPAVILIFIAVPSFSLLYAMDQIWQPLFTIKVLGNQWYWSYEY |
| A0A446TU75 | 1-80 | MLVRALWHFNEKTNPIPQRIVHGTTIEIIRTIFPSVILLFIAIPSFALLYSMDGVLVDPAITIKAIRNQWYWSAPLKRVI |
| A0A453BCM5 | 19-98 | None |
| E6ZES9 | 75-158 | None |
| A0A4S4EB91 | 180-270 | None |
| A0A0E3DBJ2 | 1-89 | None |
| Q5U6C7 | 55-145 | None |
| A0A699ZBL6 | 43-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.