DPCstruct | MC38564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 65.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05241 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A199VSG9 | 52-137 | GRCSKITKTDRLLMCWWAFTGLTHIILEGYFAFTPEFYKEKTPHYLAEVWKEYSKGDSRYVGRDAAVVTVEGITAAIEGPACLLAV |
| A0A446TSE9 | 1-73 | MCWWAITGLTHLIIEASLLFTPNYLTKENPSFFDEIWKEYSKADSRYATGDTTTTAIEVIAVFLQGPLSLLAV |
| A0A446TSF2 | 1-72 | None |
| A0A833RCA3 | 1-89 | None |
| A0A7I8JD76 | 21-98 | None |
| A0A0D9V9I9 | 45-129 | None |
| A0A7J7BXN1 | 1-72 | None |
| A0A397YXY4 | 46-131 | None |
| A0A822YSJ1 | 50-133 | None |
| A0A498HJL5 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.