DPCstruct | MC38560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 340 ± 72 aa |
| Standard deviation of domain lengths | 72.15 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 70.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.06 |
| Pfam Score | 74.29 |
| Assigned Pfam label(s) | CL0175- PF10149- PF04194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N4NZC7 | 10-302 | APTVELGFAVEAPGWRLRSEQFPSKVGGRPAWLSERDLPGPAELACPLCSRPLVFLLQLYAPLPDRADAFHRSLFVFCCREPPCCAA… |
| D8LY88 | 10-227 | AVELGFLVSPEDNWHVWDSAKFGGKPYWLVPEHIPGCDDLKCQFCGKTMCFMMQLYNPCDDNENAYHRSIYIFVCRNQKCLEKGSVC… |
| A0A1Y1WEP8 | 6-400 | None |
| A0A3M6WRQ3 | 140-578 | None |
| A0A7R8H1A6 | 12-296 | None |
| A0A7R9TN02 | 46-405 | None |
| Q0JLR9 | 42-274 | None |
| M8CYZ5 | 1-368 | None |
| A0A5D6Y4W6 | 2-395 | None |
| A0A2P5BJE1 | 40-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.