DPCstruct | MC3856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 134 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T3ALQ0 | 385-513 | WTSAMLCHGFTVTMKDSIAFIVDLNEQQMREFNMPRFGNMWIHTYTMVPKPGAPLDVIEWYIAVIREESSRTVDQSLPNIQAEIHRE… |
| T5A0U9 | 588-721 | ARLVNAALACPGFTPLMKDNISWLLNIPEAEQRFFGQPPFAHSWRHQYSLAPKPGIPLDVIEWYVSVIREQTNRDMLGQSHSSRTAL… |
| A0A4Q7JHY7 | 876-1022 | None |
| A0A4Y8DA34 | 223-348 | None |
| A0A2K0UNE8 | 1-134 | None |
| G2QM81 | 210-353 | None |
| A0A2K0T813 | 726-860 | None |
| A0A369H5B1 | 410-531 | None |
| A0A0F9ZJW7 | 780-915 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.