DPCstruct | MC38558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 167 ± 41 aa |
| Standard deviation of domain lengths | 40.87 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 76.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136KND0 | 10-156 | LKSAILGLFKVPALYGVVLALIVKLTGFQIPIPVARTIDIAANGAIPSMIVLLGLELTKIEWSNNFRALSVGVATKLLIAPLVGLIL… |
| A0A4V2T4H0 | 6-122 | LMRPVELLGQAAIPTLLVVLGIQLSMAKLVFDKSFITISSILRLIIYPIIAFILLPLFFELNTITAKVILVLSATPAAVSTTLFAIQ… |
| A0A284QQM7 | 763-1001 | None |
| A0A803KQJ7 | 158-312 | None |
| A0A485NBS1 | 4-139 | None |
| A0A1E3NKQ6 | 39-254 | None |
| A0A2E3ER78 | 9-152 | None |
| A0A4Y1QLS2 | 289-430 | None |
| A0A388LBL6 | 342-504 | None |
| M7YI61 | 5-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.