DPCstruct | MC3855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 160 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3DZI7 | 206-350 | ALSNMLFDTSTYRLSAVLDFDFSHLGAPISEYFFSFWDIGEVLPGRAKPEGPVRDWLLSGFPESVDPKFELLRVWDYALNEAGVQKP… |
| A0A090D7J2 | 4-173 | SVIIVKTQETFDRAQPTSYLDETSGRITALIDYDFAWISHPSYEFLCSFDGLGGQFRGWSCDKESWEVALRDAKLHGFPASLPSTSE… |
| A0A0F0IH36 | 577-738 | None |
| A0A7G5KK51 | 376-537 | None |
| A0A4S9WLR8 | 8-168 | None |
| A0A6G1J435 | 164-327 | None |
| A0A484FLC2 | 67-223 | None |
| A0A165FPA4 | 328-507 | None |
| E9ENM1 | 1-146 | None |
| A0A063BLY5 | 3-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.