DPCstruct | MC38545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 228 ± 30 aa |
| Standard deviation of domain lengths | 29.80 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 17.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12787 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M8BJH1 | 2-237 | NTHDSEQDNGKRLLTAVERILEDSESIIRFVQALEASTARGDSASAHRDAVAKKLITHYSNQTALAGGLTSLPAIVPGPGTLFAAFG… |
| A0A522CXR1 | 89-325 | AYEAWARGEVAHWRAQVLRPPSALDRAARGVQGRINQIIPEKVHAAITTVIEGMTRTILTGADLTTARPLTGATLAERDRRALAAID… |
| A0A123SCD4 | 14-195 | None |
| A0A7Z6XJB4 | 2-215 | None |
| A0A3M1EU02 | 4-223 | None |
| A0A7Y1XUN4 | 16-237 | None |
| A0A812U8Z5 | 13-270 | None |
| A0A7T0KIT2 | 14-282 | None |
| A0A7W8X0A4 | 12-261 | None |
| A0A4P7RMT6 | 4-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.