DPCstruct | MC3854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 61 ± 2 aa |
| Standard deviation of domain lengths | 2.33 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S9SW23 | 2-60 | SEKRYPCKCAICDHQFFVTKSILQHSGYNECGHGRCPKCKTFLNLTFVPELEIMRSMEW |
| A0A4V1PUQ1 | 1-63 | MDTRKRYQIMCPHCGKVQYACKSIFHEWGIPEGGHGTCLECKGAMRLIFNEEEQSMKAERWEN |
| A0A2N5LG73 | 28-84 | None |
| A0A2M8T6I0 | 1-61 | None |
| A0A414B847 | 23-85 | None |
| A0A100HNG4 | 2-57 | None |
| A0A1S8LD43 | 1-61 | None |
| A0A3A9AKT0 | 6-67 | None |
| A0A7U9N0M2 | 3-64 | None |
| A0A7I0FD35 | 8-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.