DPCstruct | MC38532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 383 ± 68 aa |
| Standard deviation of domain lengths | 67.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5MUI9 | 5-293 | SLQLTGEEAIEWHAILDECNATSHNASMTSDDIVVQCSSEIKLFFKKFPDCNEKFRYFMIGGWGDFSGLFQVSIWINADFAESVIIV… |
| A0A0N4ZLN6 | 34-400 | EAKDMKHKKECADDVVNESGSTGKPLLIEALYNISITLTVEEKVIFEQFIIELEGLFISENYTSIEIVMESSFKIKLFFLKYPQFYV… |
| A0A183UK82 | 77-517 | None |
| A0A0N4ZX33 | 561-974 | None |
| A0A183UJ04 | 30-406 | None |
| A0A4U5MQG5 | 470-931 | None |
| A0A0B2USF1 | 161-555 | None |
| A0A4U5MUH6 | 29-340 | None |
| A0A4U5MUR5 | 20-242 | None |
| A0A4U5MV80 | 56-479 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.