DPCstruct | MC3853
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 104 ± 17 aa |
| Standard deviation of domain lengths | 16.56 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15605 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S8RWE2 | 76-179 | KITTSQRATLNQQERTYSHLTEMDLKGAQRDLDGDPVPKPSGGYYDHAQEVSDAYRGLVELKRSWEGMLKNPNLDAELRQLYTSKLN… |
| A0A4Q2B4Z3 | 4-99 | ADNIINDHLKSSDLSAALGDLQGNPIAKPNGGYWNHAQEVKDAYTGLVRTEKTLAGSLQNPNLAPDVRAFMQGKYDSISNYISIIEE… |
| B5CLC2 | 180-275 | None |
| A0A0U3P9T2 | 444-563 | None |
| A0A1H8B5D5 | 101-194 | None |
| K8B4B4 | 259-362 | None |
| A0A6H1NF04 | 20-166 | None |
| A0A4U9QZZ0 | 37-143 | None |
| A0A7W1ZJN6 | 146-253 | None |
| A0A2P8MAW4 | 12-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.