DPCstruct | MC38528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 367 ± 22 aa |
| Standard deviation of domain lengths | 22.30 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1JDG6 | 278-631 | EDVSPLDEELDTLPVAIAGAVEKCGGNEVEISFPLAEWTDLQRSGMGVGEAKTLLVRLFLDHLGDMPTSFCVHLDTDAQEIGMEHTP… |
| A0A6A6ACJ7 | 639-1002 | GFPADNALDIELLELPAGVIDVVERVSENEVEISFPLPAHTNIQRGAMGIPDAANTLLLRLLLDDSDETATSFCFHYDNDPNLGTLE… |
| A0A167H348 | 32-425 | None |
| E5A028 | 631-970 | None |
| A0A7S3ZXA1 | 2-400 | None |
| A0A674JGT1 | 1-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.