DPCstruct | MC38525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 431 ± 34 aa |
| Standard deviation of domain lengths | 33.78 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812QKV5 | 5-472 | HADRIRQKTPEEQADFEFVQGVTGTQTWPAFTPETEQRIFCRLALLVHLNKRGQQWELAEKAWMSGLLPPGIVFLCQNRPHMVLRTY… |
| A0A812PZ27 | 115-525 | APQLLPDDQAWLDHRTSDANKSKEFQSAGNIRKQKLPELTYGEDLRFPMRPAQIVYRHAGPLSHQKSAAALAYAMHDLENNFGNCRH… |
| A0A812WXZ5 | 656-1037 | None |
| A0A812WHU0 | 1-413 | None |
| A0A1Q9DQ73 | 2-468 | None |
| A0A1Q9DI09 | 141-581 | None |
| A0A813DQA2 | 415-911 | None |
| A0A812Z3P8 | 124-559 | None |
| A0A812SEQ6 | 334-741 | None |
| A0A812ZP42 | 237-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.