DPCstruct | MC38520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 434 ± 59 aa |
| Standard deviation of domain lengths | 58.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812PKK8 | 61-529 | LGFVYLETDSTLLWKVVHQSQFYRNVLQLARNDWVRAFSVGFAGILIPILLGPLGFMSPDQSASADRFTGAVRPLVDELHTWNWTSV… |
| A0A7S1S641 | 15-306 | GFWVGSAVSIALSLVMKLVGCSIQQVGIGGFMGKSMLVRQTACVHKVQIRCIEYVLRQKGFTMGKVAILCGGPDWPTSVLAGILKLP… |
| A0A7S0AKW3 | 51-484 | None |
| A0A7S2LL64 | 243-737 | None |
| C5LE19 | 354-774 | None |
| A0A7S0DVH0 | 21-404 | None |
| A0A0M0KAM5 | 71-572 | None |
| A0A812LFC2 | 185-643 | None |
| A0A7S2NPG3 | 36-422 | None |
| A0A7S2H4K2 | 4-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.