DPCstruct | MC3852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 97 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837P9G9 | 4-92 | QLVLDTQQWLNSTYGDVDGFGSVPENGLTGWDTIYGLTRGLQHELGITDLVDNFGPTTAKLFDEIADDIVPGYSGNITYIIQGGFWC… |
| U2PWS1 | 1-101 | MDQKDQMVLLTQQWLNGVYKDNINYSVIIDDGVTGWATITALTKALQIELGISTPNGNFGPATSAAFGSLSINSQPQDNWSNSEIIS… |
| A0A239FSD9 | 3-96 | None |
| A0A6N7WI72 | 4-116 | None |
| A0A345FQB2 | 2-94 | None |
| Q8GAS2 | 1-96 | None |
| A0A1R1D0V0 | 2-101 | None |
| A0A292RGQ1 | 47-148 | None |
| A0A7T2Y7C6 | 3-96 | None |
| R7N7X7 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.