DPCstruct | MC38517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 167 ± 17 aa |
| Standard deviation of domain lengths | 16.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 28.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812NPH6 | 1-165 | MAMPYSTFGQTGASAKFGTQAFVPGKRKRLNAMSVALNILLPTVAYGIVFWALAFRVHYENPHLAWAIAAFGLLVSAASFALSRFSR… |
| A0A813GAN0 | 22-160 | PGHRIRMNIVPIVLNIFIPWVVFIYCFGLTSFQLMYTSPMMAWLGVSLVFFLWLAIVLAAYCSRRFDPDPSWFTVTSLMVLACAIIG… |
| A0A812YD03 | 118-294 | None |
| A0A1Q9CYD3 | 1-194 | None |
| A0A1Q9CED6 | 518-683 | None |
| A0A1Q9CFP4 | 52-229 | None |
| A0A813LZS6 | 139-304 | None |
| A0A812X414 | 406-563 | None |
| A0A813BUM4 | 928-1120 | None |
| A0A812I7K0 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.