DPCstruct | MC3851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 4.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1U573 | 1-77 | MKRNLKWFILGLIVYTCLLVTDFSLAQSDKAPIFAVNTVTYKDGGTKVYMGLGYKVIRYHVIEGRQDTDFGTWFIEY |
| U2NM31 | 1-90 | MRKYKNILAFVILLIAIGFVTYNIDSKRISGEEKPIFVVPTSVAKDGGTTVYRGLGYKVIRWKMISIRQVDGNEVQGFMTGYEISTM… |
| A0A3D0YUD7 | 2-82 | None |
| A0A2N1Q8A0 | 1-83 | None |
| R6ELK8 | 110-192 | None |
| C0EI66 | 10-93 | None |
| A0A847NTU3 | 1-80 | None |
| A0A3B8SLE0 | 15-104 | None |
| R6SK79 | 101-178 | None |
| R6AWF7 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.