DPCstruct | MC38508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 330 ± 81 aa |
| Standard deviation of domain lengths | 81.10 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 74.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.43 |
| Pfam Score | 99.28 |
| Assigned Pfam label(s) | CL0382- PF20246 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8MV20 | 41-366 | HADTRTFLKYYLSRRIDKDVAGIIRGLDPQEEMMRAACRMSRTIDPNRPQELTTAQSSSVNQLPEIQDLIRRRDHLGRRLGRPLSQH… |
| A0A5N6ZJ72 | 1-225 | MRADIDNAGTAGDRERLNAGYRAQKKRIYARELEQYREEWAQEPQDQIILTRGKECPIYVEQTAEKKTWCEIMSELGRLVTVMSSDK… |
| A0A194VK37 | 8-458 | None |
| A0A194VKI4 | 284-721 | None |
| A0A1B8EJB5 | 277-573 | None |
| A0A1V6RK18 | 57-384 | None |
| A0A4Z0YHY3 | 149-527 | None |
| A0A178EMB4 | 40-339 | None |
| A0A3N4JDF9 | 190-537 | None |
| A0A2B7WQY8 | 70-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.