DPCstruct | MC385
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Standard deviation of domain lengths | 6.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 43.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A3IWG4 | 1-72 | MKIMNKQENSLNLPPTIPNFRKELEQAIMLLGNRVQTDLKDKTKKKLIKLVGEYPTKETAYEWKLSLKQIVK |
| A0A4Q5Y4B8 | 4-64 | LPPRVPTELAQLDQAITLLGNRTKSALTEKPRKQLLELLGAYPDPATAVRWKAELRQIRKE |
| A0A2T1CKT4 | 1-75 | None |
| A0A1D9FXY4 | 3-59 | None |
| A0A7J7IE28 | 46-118 | None |
| A0A6B3N8K2 | 56-131 | None |
| A0A6P0YTC5 | 1-75 | None |
| A0A2T1E102 | 1-68 | None |
| B7KIZ7 | 1-73 | None |
| A0A3B8JSU2 | 7-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.