DPCstruct | MC38499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 157 |
|---|---|
| Mean domain length (aa) | 68 ± 7 aa |
| Standard deviation of domain lengths | 6.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.40 |
| Pfam Score | 90.16 |
| Assigned Pfam label(s) | CL0001- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498LVY3 | 1-71 | MSYLRCKCNLHAGQCSLRDGTLQCDCEHNTTGQDCSACERGFKAKSWKPGSYLPTPNGSPNICEASGTSDS |
| A0A2H1CD38 | 76-153 | WRPATRDSANACERCNCNNHASACYFNPVLYIKSGNVSGGNCHGCEHNTEGPNCEFCQPNFYRHPSYPIDHPNTCQRK |
| A0A3B3VTP3 | 485-547 | None |
| A0A3Q0KS26 | 339-396 | None |
| A0A5K4ER74 | 333-396 | None |
| A0A2T7PYJ5 | 161-219 | None |
| A0A5B7CY74 | 154-226 | None |
| A0A4Z2GPJ3 | 78-153 | None |
| A0A368G7F6 | 7-70 | None |
| L8YI80 | 190-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.