DPCstruct | MC38497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 116 ± 15 aa |
| Standard deviation of domain lengths | 15.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 46.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498LSY5 | 1-137 | MSAKKRADFTRRSRSPAVSEAEMFGDFQEWCLRTYGDSGKTKTVTRRKYNKILQTLLQSDDSEGVYIESNHINAKFKFWVKSKGFQV… |
| A0A6P8Z056 | 357-444 | ISSYQPWVILTYGDAAKTKTITLAKYARIVRTLRGEEVNSAENSKFRFWVRSKGFRLGAPEPDGHARKPADDILGSYGIDTRSGHLYV |
| A0A6J0C8A9 | 218-336 | None |
| A0A3P4RP23 | 3-93 | None |
| S9WKQ2 | 5-113 | None |
| A0A6P9AYW8 | 8-125 | None |
| A0A670IDS0 | 327-439 | None |
| A0A1U7T6X8 | 1-104 | None |
| A0A6V7KFU9 | 291-395 | None |
| A0A154P874 | 121-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.