DPCstruct | MC38496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1393 |
|---|---|
| Mean domain length (aa) | 94 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 21.62 |
| Pfam Score | 95.89 |
| Assigned Pfam label(s) | CL0113- CL0020- CL0003- PF16172- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8JTF1 | 265-335 | IYYFGGQNAHNQIAIYPHQPRTEDEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVK |
| A0A498LMZ3 | 1-77 | MACSKLAVDKKRKVDFENHKCVALCDFTPEDDDELKLLKGETIEILKKSEGRWWKGKKNNQTGFFPTSYVKEIEPSK |
| K7FGC2 | 233-302 | None |
| C3ZEF1 | 2-104 | None |
| A0A6S7GST5 | 119-205 | None |
| A0A6S7FWY9 | 715-801 | None |
| A0A7R9L426 | 43-139 | None |
| A0A7R9L1J9 | 362-443 | None |
| A0A1D2N5U5 | 55-173 | None |
| A0A7R9KZL5 | 109-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.