DPCstruct | MC38493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 92 ± 5 aa |
| Standard deviation of domain lengths | 5.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 69.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0GQ30 | 3-90 | GEKRKLSELRVVDLRHELEERGLDTTGVKTILLERLKSALIDEEEDPDTFVFIIGGGTPKKSATPAAPAASATPNKKAETEDDKEESG |
| A0A498LB65 | 1-95 | MASGAISAETKKITDLRVVDLKSELKRRNLDVTGVKNTLIARLKQAIEDEGGDPDNIEITVSADTPTRKHSKSKGKKTDLDADTTME… |
| A0A3Q3XEA7 | 5-100 | None |
| A0A6J2YU00 | 6-87 | None |
| A0A6P4EUV3 | 3-95 | None |
| A0A2H1CIX3 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.