DPCstruct | MC38492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 174 ± 17 aa |
| Standard deviation of domain lengths | 17.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 38.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4XSI1 | 24-167 | CSDACEDRGSGYYWCNTQKGWDYCSPSNNVDYKGNICHKDYTCSREGQNYYWCYLEKGGWGYCAQMLPKTMTHYTRYQEECINPCQY… |
| A0A498L7B1 | 25-190 | GCQCTIDGEIKTCCSTPCLYQENLNSYRCYSGQTQIECSPRYSLITYKGEKCLDDHPCSTYSYDYYWCKKISGSWDYCSPPLWRSIA… |
| A0A6P6JXH1 | 298-479 | None |
| A0A498MLS9 | 87-255 | None |
| R4GB09 | 104-283 | None |
| A0A4W6E6X7 | 40-188 | None |
| A0A498M1M3 | 101-277 | None |
| A0A3N0XV52 | 250-440 | None |
| A8KB42 | 180-385 | None |
| A0A0P5US58 | 22-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.