DPCstruct | MC38491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 136 ± 41 aa |
| Standard deviation of domain lengths | 41.45 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 73.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498L770 | 155-261 | LTLEFAPEKLVVQSPRKVRVMSDLKTASQWCMENSGDLLGSIQLPRILCMEDEEAAEALDRFFSAEFINDDLVEPLIFVFEFMQDMH… |
| A0A6P3WDV9 | 85-171 | GIMRDLRAALRWMRSNNQRFRGQVTEPSVLQMVEEDQQEALKTALESDYPEAKDPFLFIFQFREDMDAFVDACADDQGLQISCMFLE |
| A0A498L817 | 279-424 | None |
| A0A6P6KRL0 | 34-186 | None |
| A0A1A8L3P1 | 575-754 | None |
| A0A6G0HEW1 | 87-177 | None |
| A0A437DFY7 | 87-224 | None |
| A0A498MWD4 | 307-412 | None |
| A0A6P6RL20 | 103-333 | None |
| A0A6P8VB18 | 418-610 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.