DPCstruct | MC38490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 95 ± 23 aa |
| Standard deviation of domain lengths | 22.53 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7Y7E1 | 227-297 | IPASDKGRFFAFGRVFAGKVCTGMKVRIMGPNYVPGEKKDLYVKNVQRTVIWMGKKQETVEDVPCGNTVAM |
| A0A163K1R3 | 283-357 | KDQMVPTSDKGRFYAFGRVFSGTVRAGMKVRIQGPNFIPGTKTDLHVKSVQRTVLMMGRGVEAIDDCPAGNIIGL |
| A0A7J7J583 | 2-123 | None |
| G3PG32 | 212-327 | None |
| A0A2H8TR70 | 181-293 | None |
| A0A813M100 | 155-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.