DPCstruct | MC38487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 102 ± 21 aa |
| Standard deviation of domain lengths | 21.40 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 54.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13310 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R1GVA0 | 1-124 | MNYYNLDAIISVGYRVNSIQATEFRKWATKTLNEYMIKGFVLDDERLKQGSNLLNQDYFDELLERVRSILASERRIWQKITDIFQEI… |
| D0BLS8 | 1-84 | MILAIGYRVQSPRGIQFRKYASTVLKEYFIKGFTMDDERFKNLGEDNYFKGLLERIYDIRFSEKVFYRQLLDLFAMSVDYNKDS |
| A0A0F3GLA2 | 91-178 | None |
| A0A174E8B8 | 1-126 | None |
| A0A5C9BC94 | 6-95 | None |
| A0A378WF79 | 1-89 | None |
| A0A391PEG5 | 8-155 | None |
| A0A5E5QPC4 | 9-134 | None |
| A0A6B1E2X5 | 1-102 | None |
| E8LJ97 | 4-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.